Connecting to LinkedIn...

MySalarySurvey

W1siziisijiwmtyvmtavmtavmtivmdkvndivntqvmtgwede4mc5wbmcixsxbinailcj0ahvtyiisijmwmhgymdbcdtawm2uixv0
MySalarySurvey is a hosted application that enables you to rapidly deploy a salary comparison website for your industry on a sub-domain of your existing site or on an independent domain.   You may simply wish to operate a leading salary survey or incorporate banner advertising to generate revenue or even build a talent community, attracting candidates and turning your salary survey into a hiring platform.   To cater for each scenario, we offer:  Premium - Salary Survey + Banner Advertising + Job Board Standard – Salary Survey + Banner Advertising Lite – Salary Survey only   Our service is designed to help you to attract quality passive candidates, strengthen your industry profile, and provide trusted remuneration consultancy to your clients. For more informat...

Company Details